Sample 3300000932

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000932

3300000932: Aerobic enrichment media microbial communities from Eden Landing Ponds, California, USA - A23 P3 (2)

Overview

Basic Information
IMG/M Taxon OID	3300000932 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053056 \| Gp0054299 \| Ga0001890
Sample Name	Aerobic enrichment media microbial communities from Eden Landing Ponds, California, USA - A23 P3 (2)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	101197369
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
Type	Engineered
Taxonomy	Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Emeryville, CA
Coordinates	Lat. (^o)	37.840854	Long. (^o)	-122.289843	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033243	Metagenome	178	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
JGI12479J12853_1005162	All Organisms → cellular organisms → Bacteria → Proteobacteria	4182	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12479J12853_1005162	JGI12479J12853_10051621	F033243	QGPIDLVGHGAEPVLAAGYSTLELERAGLTVEKARELGIPVDAGRCSGVGANVMQLRALLTS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.