NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000692

3300000692: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25



Overview

Basic Information
IMG/M Taxon OID3300000692 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0075432 | Gp0054565 | Ga0001948
Sample NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7426224
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameTropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → tropical forest → forest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)N/ADepth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000466Metagenome / Metatranscriptome1105Y
F003090Metagenome / Metatranscriptome508Y
F007624Metagenome / Metatranscriptome348N
F016190Metagenome / Metatranscriptome249Y
F031318Metagenome182Y
F035932Metagenome171Y
F040358Metagenome / Metatranscriptome162N
F058548Metagenome / Metatranscriptome135Y
F078037Metagenome116N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12380J11932_100142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1670Open in IMG/M
JGI12380J11932_100194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1540Open in IMG/M
JGI12380J11932_100429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1175Open in IMG/M
JGI12380J11932_100465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1146Open in IMG/M
JGI12380J11932_101482All Organisms → cellular organisms → Bacteria → Proteobacteria694Open in IMG/M
JGI12380J11932_101508Not Available689Open in IMG/M
JGI12380J11932_101681All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium652Open in IMG/M
JGI12380J11932_101834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria629Open in IMG/M
JGI12380J11932_102893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12380J11932_100142JGI12380J11932_1001423F058548AAKNAPFDGAETGGAEAHIAEQSRSWRAASGERAVMRGS*
JGI12380J11932_100194JGI12380J11932_1001942F000466VKRDWVPTGRIDFATRFYGNLEDSDQPSEFKLIVEERRIVESITGNENLEIQWRLATLNEAKVVVAQYHKYLSENSLIKSVFDEPASLPPPKRIQKIQESTAA*
JGI12380J11932_100429JGI12380J11932_1004291F078037MDVKLITAILVTAAMASAALAQGPSTEKLKADAQEVVKIISSDSAKAQAYCETIKLGDQMDQAEQNNDSDKAEGLSKKMDELNQKLGPEYLKLGQDLQDIDPNSPDGLELGRTLAALDKLCK*
JGI12380J11932_100465JGI12380J11932_1004651F031318MRTTTIATVAVVVLALLIVAKSRTVGLTEATGNPQQNTVSTYDLSVGHPNMK
JGI12380J11932_101482JGI12380J11932_1014823F035932MVIPVGLPGAQQLVVAEKDLSGRVTTKEIMPVLFSVLEESDXPXFRASXSX*
JGI12380J11932_101508JGI12380J11932_1015081F016190VVFPGSTAGDNTLRFRVISELPGVEGTLAESVLKRLSEPVGTRSSNVWEAEADGRHYFVAVGQVSNIDWPWQVVVTVPRTGLLQAASKSTVILIGAMGLAALIALAIGYATSRTIGAPMTRLLSNAQLARHGNIELMEDVNTGLREIDETGKILKELATQQRGRERR*
JGI12380J11932_101681JGI12380J11932_1016811F007624QLREGSFHGPRPTCPKHPKQRVHRHGFYVRFENCDSQRRLRIERFVCPRCGRTLSVLPKNRLPYVAVNTTILESDFDARASGTDPPSCSEKERGCLGRAFERFADRVAPLCALLGQMIRGIKPSVSECWRALRQLDNLEGILLLLGTKFNTSLLADYRCLQPGF*
JGI12380J11932_101834JGI12380J11932_1018342F040358MRIAIFALAVLAGGGAAEAGQIEVISASPRHIEIAAWCWTAGSNCQQEASDVAQGYCHGSDYPHYPRRALYVRSGILERDFFSERVIFVYRCNRRSIICEAGSC*
JGI12380J11932_102893JGI12380J11932_1028932F003090LEKMTVIDYKGYRIEVGPVGKGWRASIFSPGSIRPWPNSPANLEKSSAEELVAEAKRIIDVRLGPRRL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.