| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000680 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0075432 | Gp0054812 | Ga0001955 |
| Sample Name | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 5465220 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → tropical forest → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Luquillo Experimental Forest Soil, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.0 | Long. (o) | -65.0 | Alt. (m) | N/A | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012657 | Metagenome | 278 | Y |
| F031584 | Metagenome / Metatranscriptome | 182 | Y |
| F088860 | Metagenome / Metatranscriptome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12452J11691_100005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2859 | Open in IMG/M |
| JGI12452J11691_100062 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| JGI12452J11691_100928 | Not Available | 567 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12452J11691_100005 | JGI12452J11691_1000051 | F088860 | MGPPLRSFAADAHDCIMVRVLGPTEYKVAARLNRARAGSPLIVI |
| JGI12452J11691_100062 | JGI12452J11691_1000623 | F031584 | HPTGGMSTKGHVWTAPWQELSDASAALVGCGHVSGLLMRPM* |
| JGI12452J11691_100928 | JGI12452J11691_1009281 | F012657 | PVMIAASLHQMAEKYDPQVAPXTLHLPEAVHADFREKVFLYREANVLLALVDRVNPSSDGRDSLFEPVFWEYERIIFRESSDHFGELSDHPILRAARRESVAAALQDLNFRMHPPRVNKWDFAVDWSRNWFAGIGHNELNPARLERFSEFWSREYTAVQQALDATVTTGR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |