| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000672 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0071004 | Gp0053927 | Ga0002407 |
| Sample Name | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 4623216 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → solid layer → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | El Dorado National Forest, Georgetown, California, USA | |||||||
| Coordinates | Lat. (o) | 38.88 | Long. (o) | -120.64 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005599 | Metagenome / Metatranscriptome | 395 | Y |
| F008658 | Metagenome / Metatranscriptome | 330 | Y |
| F012266 | Metagenome / Metatranscriptome | 282 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI11858J11886_100422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 730 | Open in IMG/M |
| JGI11858J11886_100454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| JGI11858J11886_100511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI11858J11886_100422 | JGI11858J11886_1004222 | F005599 | MRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG* |
| JGI11858J11886_100454 | JGI11858J11886_1004541 | F008658 | MGKLMAEQKEREYNRGQKAASEGRSRSWSEPWAYPFESDQHYEERREAFNQGYGIIDATPPNYNRNQSAGD* |
| JGI11858J11886_100511 | JGI11858J11886_1005111 | F012266 | GLALQLPFFEVMALSFRLVGSAPERPCDDVCGLNPLLSESDGDAADFLD* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |