| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000664 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0075432 | Gp0054748 | Ga0001985 |
| Sample Name | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 62 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2804079 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → tropical forest → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Luquillo Experimental Forest Soil, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.0 | Long. (o) | -65.0 | Alt. (m) | N/A | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007495 | Metagenome / Metatranscriptome | 350 | Y |
| F050785 | Metagenome / Metatranscriptome | 145 | Y |
| F083637 | Metagenome / Metatranscriptome | 112 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12418J11929_10075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1348 | Open in IMG/M |
| JGI12418J11929_10778 | Not Available | 534 | Open in IMG/M |
| JGI12418J11929_10864 | Not Available | 512 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12418J11929_10075 | JGI12418J11929_100751 | F083637 | ICSVTLALGLAGCGWAGKTPIIGKGKAPAPVVTKG* |
| JGI12418J11929_10778 | JGI12418J11929_107781 | F007495 | TYELDAFKSNLTRTEADKRIAMLTAKLKLLDEPPHTI* |
| JGI12418J11929_10864 | JGI12418J11929_108641 | F050785 | MLILVRRSQICNSRIVSALPSCGRLPATVPDLTNRARQLVFLTPINSQLNDFLNEIHQIARLEPSIVDRIDEDLDLHAKKKKLQRLIDAQFLAGQTPDLPKLQLQLRELKLDNIDLEIGRPRTEAYIVYLFL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |