Sample 3300000662

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000662

3300000662: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 2

Overview

Basic Information
IMG/M Taxon OID	3300000662 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0075432 \| Gp0054328 \| Ga0001925
Sample Name	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 2
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	1723206
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	forest biome → tropical forest → forest soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Luquillo Experimental Forest Soil, Puerto Rico
Coordinates	Lat. (^o)	18.0	Long. (^o)	-65.0	Alt. (m)	N/A	Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085267	Metagenome	111	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
JGI12492J11902_10162	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12492J11902_10162	JGI12492J11902_101621	F085267	MSFLRHGEIYPWHEGTISRPCPRPSQWMSFQPVIPGGLLSSRARVRFT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.