| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000658 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0075432 | Gp0054837 | Ga0001961 |
| Sample Name | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 38 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 805377 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → tropical forest → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Luquillo Experimental Forest Soil, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.0 | Long. (o) | -65.0 | Alt. (m) | N/A | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007624 | Metagenome / Metatranscriptome | 348 | N |
| F078037 | Metagenome | 116 | N |
| F085267 | Metagenome | 111 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12336J11891_10035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1298 | Open in IMG/M |
| JGI12336J11891_10113 | Not Available | 702 | Open in IMG/M |
| JGI12336J11891_10196 | Not Available | 517 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12336J11891_10035 | JGI12336J11891_100351 | F085267 | MSFLRHGEIYPWHEGTISRPCPRPSQWMSFQPVIPGG |
| JGI12336J11891_10113 | JGI12336J11891_101132 | F007624 | CSEPMQLREGSFHGPRPGCPEHPKQRVHRHGFYVRFENCDSQRRLRIERFVCPRCGRTLSILPKNRLPYIAVNATLVESEFDARTSGTDPPSSSEKERGCLRRAFERFAARVTPVCALLGQMITRIKPSVGECWKELRQLDNLEGILLLLGTKFNTSLLADYRCVQSGF* |
| JGI12336J11891_10196 | JGI12336J11891_101961 | F078037 | GLEKCKSSRAVSELEALMDVKLIAAVLVTAATASAALAQGPSTEKLKADAQKVVKIISSDSAKVQVYCETMDLSDQMDDAEDANDSAKAEGLRKKIDELNQKLGPEYLKLVQDLEGIESNSRDGQEIGRTLDALDKLCK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |