x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300000452
3300000452: Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2
Overview
Basic Information |
IMG/M Taxon OID | 3300000452 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0071004 | Gp0054728 | Ga0011535 |
Sample Name | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 1278111 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | forest biome → solid layer → forest soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information |
Location | El Dorado National Forest, Georgetown, California, USA |
Coordinates | Lat. (o) | 38.88 | Long. (o) | -120.64 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F037213 | Metagenome / Metatranscriptome | 168 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
MB_CA_Ref_M2DRAFT_10123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 884 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
MB_CA_Ref_M2DRAFT_10123 | MB_CA_Ref_M2DRAFT_101231 | F037213 | MGPPPRSFAADAHDCIMVRVLGPTGYKVVARLIAPERGLPSDRHPDRTKRAVVLEAVKVWPGNGGACRKGLVRRPTLTVSVRASGKRGAGRDEETGSQIEQRN* |