| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000433 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0071004 | Gp0054792 | Ga0011547 |
| Sample Name | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2026191 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → solid layer → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | El Dorado National Forest, Georgetown, California, USA | |||||||
| Coordinates | Lat. (o) | 38.88 | Long. (o) | -120.64 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028660 | Metagenome / Metatranscriptome | 191 | Y |
| F031228 | Metagenome / Metatranscriptome | 183 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| MB_CA_Ref_M3DRAFT_10302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 695 | Open in IMG/M |
| MB_CA_Ref_M3DRAFT_10476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 550 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| MB_CA_Ref_M3DRAFT_10302 | MB_CA_Ref_M3DRAFT_103022 | F028660 | MGIAEESLDAEGFVKPVMLGELISVIEADGFAYRLWKFTELTSDGPGGEDSFSIDRVPNHAEAGLSFVENQQPLATSGEQHEVGFPMARRPAAFDLGGAFGDRAPLFDEAGGAASWVSSAPSSSFVARQQAMPVILLGRTMIDETID* |
| MB_CA_Ref_M3DRAFT_10476 | MB_CA_Ref_M3DRAFT_104762 | F031228 | MDHREIAVRVPVMNEVQFLFASEPCKPLKPRSLYVVFLVEKDVRVERRRTCNYLNHEEINGQYEVCTSSYQKHRNEEEGCIVAFVTAVRP* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |