| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000426 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053056 | Gp0053721 | Ga0026743 |
| Sample Name | Marine sediment microbial community from Union City, CA, USA - Pond 1C Sediment 3 |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 90642744 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → pond → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Eden Landing Ponds, San Francisco, CA, USA | |||||||
| Coordinates | Lat. (o) | 37.569083 | Long. (o) | -122.103267 | Alt. (m) | N/A | Depth (m) | .29 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F094909 | Metagenome | 105 | Y |
| F102576 | Metagenome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| P_1C_Sed_3_UnCtyDRAFT_1000884 | All Organisms → cellular organisms → Bacteria | 6404 | Open in IMG/M |
| P_1C_Sed_3_UnCtyDRAFT_1003862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2421 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| P_1C_Sed_3_UnCtyDRAFT_1000884 | P_1C_Sed_3_UnCtyDRAFT_10008845 | F094909 | MVVMYNEKILDWVEGYVLTRMLIFGDFVGTVDRTELMFDLDTNSDYFRIHEGQRIQALSLPVKSRRLCTLLGEIEACFQRGWPLLDAGEWTKADFDEVYDLSMQISDEIMLLREEFQQKMPSEPRPSSVNPD* |
| P_1C_Sed_3_UnCtyDRAFT_1003862 | P_1C_Sed_3_UnCtyDRAFT_10038622 | F102576 | MNDLLLLERYFPGGKLEGGIALANRLDWGLSVQMSGNDYVVSSGNEPILRTESKDALQSFIYGMGLAYAVLPENLFLALEKTLREL* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |