| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000354 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0067861 | Gp0054619 | Ga0026141 |
| Sample Name | Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - CD6A |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 90602774 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Elkhorn Slough, Monterey Bay, California, USA | |||||||
| Coordinates | Lat. (o) | 36.82188 | Long. (o) | -121.744 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024806 | Metagenome / Metatranscriptome | 204 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| ElkS_mat_CD6ADRAFT_1026176 | Not Available | 590 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| ElkS_mat_CD6ADRAFT_1026176 | ElkS_mat_CD6ADRAFT_10261761 | F024806 | MVTNSNFNFTSNSIITLELPFSEHIEELRQRLFLVFGIILLLTCLAFIEVKSLVKILELPIS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |