NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000354

3300000354: Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - CD6A



Overview

Basic Information
IMG/M Taxon OID3300000354 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0067861 | Gp0054619 | Ga0026141
Sample NameHot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - CD6A
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size90602774
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springmicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationElkhorn Slough, Monterey Bay, California, USA
CoordinatesLat. (o)36.82188Long. (o)-121.744Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024806Metagenome / Metatranscriptome204Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
ElkS_mat_CD6ADRAFT_1026176Not Available590Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
ElkS_mat_CD6ADRAFT_1026176ElkS_mat_CD6ADRAFT_10261761F024806MVTNSNFNFTSNSIITLELPFSEHIEELRQRLFLVFGIILLLTCLAFIEVKSLVKILELPIS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.