Sample 3300000351

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000351

3300000351: Alkaline sediment microbial communities from bioreactor in Germany - Reactor TP_S2

Overview

Basic Information
IMG/M Taxon OID	3300000351 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0063439 \| Gp0054161 \| Ga0026139
Sample Name	Alkaline sediment microbial communities from bioreactor in Germany - Reactor TP_S2
Sequencing Status	Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	45604573
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils
Type	Environmental
Taxonomy	Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → bioreactor → sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Hypersaline (saline)

Location Information
Location	Germany
Coordinates	Lat. (^o)	53.109	Long. (^o)	8.845	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091594	Metagenome / Metatranscriptome	107	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
SR_TP_S2DRAFT_1001075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	7879	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
SR_TP_S2DRAFT_1001075	SR_TP_S2DRAFT_100107520	F091594	MNEKNITHYCLGTGELKCDGCQQEKNWQTLNEMPDTWRKSAQSRAARIDSTECILTGRPWYAPAEIRQAEEN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.