NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000236

3300000236: Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS08_3



Overview

Basic Information
IMG/M Taxon OID3300000236 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063446 | Gp0053572 | Ga0026216
Sample NameGroundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS08_3
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size181303868
Sequencing Scaffolds9
Novel Protein Genes11
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria3
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGroundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biome → aquifer → biofilm material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationFissure Spring (below trough), Frasassi Caves, Italy
CoordinatesLat. (o)43.383333Long. (o)12.95Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001506Metagenome / Metatranscriptome681Y
F002525Metagenome / Metatranscriptome552Y
F009160Metagenome / Metatranscriptome322Y
F016728Metagenome / Metatranscriptome245Y
F044511Metagenome / Metatranscriptome154Y
F065810Metagenome / Metatranscriptome127Y
F079740Metagenome / Metatranscriptome115Y
F084884Metagenome / Metatranscriptome112Y
F101438Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
TB_FS08_3DRAFT_1007525All Organisms → cellular organisms → Bacteria3053Open in IMG/M
TB_FS08_3DRAFT_1012274All Organisms → Viruses → Predicted Viral2008Open in IMG/M
TB_FS08_3DRAFT_1022901All Organisms → cellular organisms → Bacteria1130Open in IMG/M
TB_FS08_3DRAFT_1031398All Organisms → cellular organisms → Bacteria847Open in IMG/M
TB_FS08_3DRAFT_1031481All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta845Open in IMG/M
TB_FS08_3DRAFT_1033919All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
TB_FS08_3DRAFT_1044869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi640Open in IMG/M
TB_FS08_3DRAFT_1045100All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae637Open in IMG/M
TB_FS08_3DRAFT_1061972Not Available515Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
TB_FS08_3DRAFT_1007525TB_FS08_3DRAFT_10075253F009160MRVKAPQPQARLLGRAGESVTRGDRRERELGFESPFPPLTARPNKRRDDHSTLTDESSPLRGAPNERQNAAKTLTPVGHPFITPPERRSAPTTVRQARNGVRYGLEQVSAFIGIRNXLFVL*
TB_FS08_3DRAFT_1009056TB_FS08_3DRAFT_10090563F016728VHSGNLLLIYSQPTVCVTCVWAGVDSAWEQEKLEAWKMLENAAESHTSGARFVGTLLTLRLTC*
TB_FS08_3DRAFT_1012274TB_FS08_3DRAFT_10122742F044511MAYGIVRCPTKRAPDAGDSGAIPSIFLRLSIFPVGRRSAARPSAGNANR*
TB_FS08_3DRAFT_1022901TB_FS08_3DRAFT_10229011F002525CVWAGVDNVWEQEKLEARKILENAAESHTSGARFVGSF*
TB_FS08_3DRAFT_1031398TB_FS08_3DRAFT_10313981F084884QSVHPTLGILARFQAFFYASAFSQSDGVPPPDPARVTQTIGTTRA*
TB_FS08_3DRAFT_1031481TB_FS08_3DRAFT_10314812F001506LYQQEILKLISKLIEKENVKETNLMNRILYEIRCKCNEEISITKKRKSTNRSEGKPLLYPNPTELTSKTFQIKYDKPLSSIAKFLLNSFQNKYLYYAIDDLLYLLNSNITERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYISEIVTRNKFLTNPNQNVESVTYITIKLLYRTKIPVKKQESLW*
TB_FS08_3DRAFT_1033919TB_FS08_3DRAFT_10339192F101438MMFRQKLFACVLMLALAPAWADSSVPAVPEKQTARFEQLLDFRHNVDLVRHPQQALDLADAMSDPEFLVAAMVMSANPEVWLKAMERAGAPGVPQNLAQAASPEMLADWFYSSIDPRFQQAILSRMLDPKKAQRWMQSMSDPRFCMPALAVVSPETPMQWVKVTADGRVMQSMQPWFDPTTYMNWMRLPTPSAAKKSSDKMARPAAYSWKPLQRY*
TB_FS08_3DRAFT_1044869TB_FS08_3DRAFT_10448692F002525AGVDNAWEQEKPEARKMLVXRAESHTSGARFVSQPAR*
TB_FS08_3DRAFT_1045100TB_FS08_3DRAFT_10451001F065810YYAIDDILYSFQSNPNERDNLLAILYSPVLSLQNNFSINFFDIWIDEIYIHEVSKINKFLKNDSSKSEQCSYITIKLLYKSGIPFKKPDPLW*
TB_FS08_3DRAFT_1057647TB_FS08_3DRAFT_10576473F079740MRTQKIDFPDRQTLCIFPDKREDLAEAITELQLGGNFPVIVLIGGGIDEQEAEA
TB_FS08_3DRAFT_1061972TB_FS08_3DRAFT_10619722F084884PALGILARFKAFFYASAFFQSDGVPPPAPARVTQTVGTTLAKLKFQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.