NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000145

3300000145: Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_IL



Overview

Basic Information
IMG/M Taxon OID3300000145 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053053 | Gp0053390 | Ga0026200
Sample NameFeedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_IL
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size85065922
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFeedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca
TypeEngineered
TaxonomyEngineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationNewby Island compost facility, Milpitas, CA
CoordinatesLat. (o)37.454581Long. (o)-121.928712Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005068Metagenome / Metatranscriptome413Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
NICFPass4ILDRAFT_c013075All Organisms → cellular organisms → Bacteria → Proteobacteria1209Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
NICFPass4ILDRAFT_c013075NICFPass4ILDRAFT_0130751F005068RPPQTLEETLEILGAHELEIDDGRDTVSETGVRHLKVEVRRNTPFSRLLDRLTERISRS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.