| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000129 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063447 | Gp0053470 | Ga0026511 |
| Sample Name | Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 04_23.45m |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 282842295 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → intertidal zone → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | S2 site, Potter Cove, King George Island, Antarctic Peninsula | |||||||
| Coordinates | Lat. (o) | -62.231932 | Long. (o) | -58.655087 | Alt. (m) | N/A | Depth (m) | 23.45 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050639 | Metagenome / Metatranscriptome | 145 | Y |
| F079376 | Metagenome / Metatranscriptome | 116 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| KGI_S2_ANT04_2345mDRAFT_c1019394 | Not Available | 1807 | Open in IMG/M |
| KGI_S2_ANT04_2345mDRAFT_c1056492 | Not Available | 796 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| KGI_S2_ANT04_2345mDRAFT_c1019394 | KGI_S2_ANT04_2345mDRAFT_10193941 | F050639 | MLRWMWRELETGLRNTLNGHEEGNLGYSQGYSLRVTAPVLDPTCVSL |
| KGI_S2_ANT04_2345mDRAFT_c1056492 | KGI_S2_ANT04_2345mDRAFT_10564921 | F079376 | MSDIVIIREPGRPCVSLGTSRVCRTTEEGGRQIKHRESDSLVVPMKAGNAAGGKEATHESVV* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |