| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2222084008 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047492 | Gp0052333 | Ga0011227 |
| Sample Name | ColmarContigsNoOGM |
| Sequencing Status | Permanent Draft |
| Sequencing Center | CEA Genoscope |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 137411117 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Traditional Grape Vine Soil Microbial Communities From Colmar, France |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Traditional Grape Vine Soil → Traditional Grape Vine Soil Microbial Communities From Colmar, France |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → agricultural soil |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Colmar, France | |||||||
| Coordinates | Lat. (o) | 48.081 | Long. (o) | 7.355 | Alt. (m) | N/A | Depth (m) | 0 to .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018688 | Metagenome / Metatranscriptome | 233 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2224065270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| 2224065270 | 2224307703 | F018688 | VTQIADEEATRVLNAFQRDARAMLEYLLPALRQRGLYPEAQVDGWGDSRGGRGTASTVVLASPKWLKPTDKTKQLARLRLQLSDSNTWAVIVSVVAQPDQLHAWPPSDETAWWTELRELIRGQIM |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |