| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2209111012 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0050868 | Gp0053095 | Ga0011210 |
| Sample Name | 2000 evening metatranscriptome |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Leibniz Institute |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 8008326 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Lentic Microbial Communities From Grosse Fuchskuhle, Germany, For Comparative Metatranscriptomics |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From Grosse Fuchskuhle, Germany, For Comparative Metatranscriptomics |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → lentic water body → fresh water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany: Grosse Fuchskuhle | |||||||
| Coordinates | Lat. (o) | 53.1058 | Long. (o) | 12.9847 | Alt. (m) | N/A | Depth (m) | .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092248 | Metagenome / Metatranscriptome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| le_contig00389.2750 | All Organisms → cellular organisms → Eukaryota | 577 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| le_contig00389.2750 | le_00164460 | F092248 | LRLLLPLSDKVYLTFHASLEDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |