NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2199352030

2199352030: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC2



Overview

Basic Information
IMG/M Taxon OID2199352030 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0047180 | Gp0053342 | Ga0011320
Sample NameCompost microbial communities from Sao Paulo Zoo, Brazil - ZC2
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Sao Paulo, Virginia Bioinformatics Institute
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size433746055
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCompost Microbial Communities From Sao Paulo Zoo, Brazil
TypeEngineered
TaxonomyEngineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationSao Paulo Zoo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020635Metagenome223Y
F022156Metagenome / Metatranscriptome215Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
2204967967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
2205008796Not Available516Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
22049679672206781235F020635MIMEFSLKQLSWIVIGALGIGGTGYLSMNSKIDELTTKVAVVHNQVATLTKQLDRIEEKLNNTKN
22050087962206813740F022156MANEIEKEIVKQAIKEWLNEKVAQFGWFSIRTIFYVFVAGLAYAYLITHGWSLPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.