| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2199352023 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047150 | Gp0052349 | Ga0011314 |
| Sample Name | C. gracilis enrichment |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Eurofins Medigenomix GmbH |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 45062473 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Chaetoceros Gracilis Enriched Algal Communities From Idaho National Lab, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Lab Enrichment → Defined Media → Marine Media → Unclassified → Chaetoceros Gracilis Enriched → Chaetoceros Gracilis Enriched Algal Communities From Idaho National Lab, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Idaho National Lab, Idaho Falls | |||||||
| Coordinates | Lat. (o) | 43.4666667 | Long. (o) | -112.0333333 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051162 | Metagenome / Metatranscriptome | 144 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| CgraS_DRAFT__Contig_2267 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 51590 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| CgraS_DRAFT__Contig_2267 | CgraS_DRAFT_00278600 | F051162 | MPLVKLFARKTLSKPVNLSSLQQKLCSIWNTKPDTTKLILTRVDDWTNDSFQEDIYVDIRAYGKKERTRDMVMDGMQQVQKAFGEEGLVANVRLEVYDGEKYFHLPPPPSTPQN |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |