NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2166559024

2166559024: Microbial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 3 version 1



Overview

Basic Information
IMG/M Taxon OID2166559024 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046201 | Gp0052372 | Ga0025131
Sample NameMicrobial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 3 version 1
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size144010113
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa
TypeEngineered
TaxonomyEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationLawrence Berkeley National Laboratory, California, USA
CoordinatesLat. (o)37.8754404Long. (o)-122.2477251Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017253Metagenome242Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
BMHB3_Sequence0000017378Not Available1290Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
BMHB3_Sequence0000017378BMHB3_00864790F017253VAFALSSANGGSYTQGRIADPESSGSSRNAARAERCTPKTTAAALDG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.