NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2149837011

2149837011: Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from post-bloom



Overview

Basic Information
IMG/M Taxon OID2149837011 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0060830 | Gp0051496 | Ga0026455
Sample NameFresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from post-bloom
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size57916305
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater algal bloomlake water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationLaBonte Lake, Laramie, Wyoming
CoordinatesLat. (o)41.321Long. (o)-105.586Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002434Metagenome / Metatranscriptome559Y
F040943Metagenome / Metatranscriptome161Y
F040944Metagenome / Metatranscriptome161Y
F042654Metagenome158Y
F069495Metagenome / Metatranscriptome124Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
LBLPo__contig00031Not Available787Open in IMG/M
LBLPo__contig00060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage658Open in IMG/M
LBLPo__contig00086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
_GVKGB5S02JMGQKNot Available528Open in IMG/M
_GVKGB5S02JWVY8Not Available524Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
LBLPo__contig00031LBLPo_00324290F040944MESMVHTENEKLFPSGGLSIPYEVGHGITLASLIDSRDYLQSELDQWTDNPKDEMNPDGYWLHPEDVVNNMKLVRAMNLLIEYYGG
LBLPo__contig00060LBLPo_00788600F040943KAEGGIQRKTCPMCGKKHNKRGEFCSRSCGNTRKHTESAKRKISKGKSAWLNSGSEEAEVAIHNFTSKGLHKTPDPVAPIVSRDLGYGRYVEDGDVWEEV
LBLPo__contig00086LBLPo_01204220F042654MLNNHEFNNLERRLWREGNPLCDELVSTRDELIFLLSQAKKVMEKYSFDLSTLSDDDDLDYFREWDEFGDALDNLTYELGIKP
_GVKGB5S02JMGQKLBLPo_00512020F002434RCGDCCLTTESHDKMIAAFQEYFKWQERFEYKGSDEAGIKARYWLSEIRNEASKRRVEIQEKREQRKTARKGMLGRPPKVIK
_GVKGB5S02JWVY8LBLPo_00612070F069495RQQQEDRMAKITLEELCDIAFAVEEGDPFDWGVFKQGQEEAMKMIGASVLEMFDKDSYTSEQKLIMLATITKLTTENMILHSKLLTNSQKDV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.