| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2088090024 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063147 | Gp0051996 | Ga0011112 |
| Sample Name | Sample MXSH |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Research Council of Canada |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 90948594 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium WCE2008 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Rumen Microbial Communities Of Musk Oxen From Alaska |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Stomach → Unclassified → Rumen → Rumen Microbial Communities Of Musk Oxen From Alaska |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Fairbanks, Alaska | |||||||
| Coordinates | Lat. (o) | 64.880776 | Long. (o) | -147.869984 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012184 | Metagenome / Metatranscriptome | 282 | Y |
| F076635 | Metagenome / Metatranscriptome | 118 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| MXSH_contig02461 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium WCE2008 | 5274 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| MXSH_contig02461 | MXSH_01977330 | F076635 | MIKRGTKVRVIKMDDAGGGFGWQAKQLNGRIFTVRYMDATKQIHLEETGIALIPGGGSV |
| MXSH_contig55613 | MXSH_00079100 | F012184 | TEGFVKVAVATALAKDTKAHKAFNAEAAIAEYKAYEAEVALREAEKANKPVKAKGPNPEAQARRDELDAKIGALPSFTEYTATDILNALSGQVAENVTVMAVGSSAKRLVEKGVLTVGNREGDKKSYYTKA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |