NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2084038021

2084038021: Marine sediment archaeal communities from Santa Barbara Basin, CA, that are methane-oxidizing, sample 9-12 cm



Overview

Basic Information
IMG/M Taxon OID2084038021 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046212 | Gp0051876 | Ga0026370
Sample NameMarine sediment archaeal communities from Santa Barbara Basin, CA, that are methane-oxidizing, sample 9-12 cm
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size90913355
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Archaeal Communities From Santa Barbara Basin, Ca, That Are Anaerobic And Methane-Oxidizing
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Santa Barbara Basin, Ca, That Are Anaerobic And Methane-Oxidizing

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine benthic biomemarine benthic featuremarine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationSanta Barbara Basin
CoordinatesLat. (o)34.21Long. (o)-119.5Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036102Metagenome / Metatranscriptome170Y
F036294Metagenome / Metatranscriptome170Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
ASA129_GJG7ZZE02GM8QFNot Available528Open in IMG/M
ASA129_GJG7ZZE02HFAUJNot Available567Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
ASA129_GJG7ZZE02GM8QFASA129_01050640F036102MDEQKMKELFRATANVQTPEGLAAYQAFAAALTIPILEKIELESIMRQLFTVEPLEPGAQASYPVAEDFEIPVWVLPGLGYIAQNFIEGIGEDVVVPTFT
ASA129_GJG7ZZE02HFAUJASA129_01947070F036294VAVMDKGFSDEAVVGIKSVADEDAVTYLRVKLPESDSNVGAEGWSMLLRTGISELWLLRVQPSEFSV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.