Basic Information | |
---|---|
IMG/M Taxon OID | 2084038018 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063180 | Gp0051997 | Ga0026366 |
Sample Name | Ant host-associated microbial communities from Gamboa, Panama - Trachymyrmex fungus garden |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 79020976 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Ant Host-Associated Microbial Communities From Gamboa, Panama |
Type | Host-Associated |
Taxonomy | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Ant Host-Associated → Ant Host-Associated Microbial Communities From Gamboa, Panama |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Fungus → Fungus corpus |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Panama: Gamboa | |||||||
Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | N/A | Depth (m) | .2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000950 | Metagenome | 822 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
TrFG_contig00421 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 5655 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
TrFG_contig00421 | TrFG_01435160 | F000950 | MLEDIDDQDSPPEDVKINSASIEEIPDPIPPSGKGKGIPKLDFPLGL |
⦗Top⦘ |