| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2061766005 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0060828 | Gp0051486 | Ga0026395 |
| Sample Name | Elkhorn Slough cyanobacterial mat night |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 55432056 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hypersaline Mat Water Microbial Communities From Elkhorn Slough, California, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Microbial Mats → Hypersaline Mat Water → Hypersaline Mat Water Microbial Communities From Elkhorn Slough, California, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | estuarine biome → estuary → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Elkhorn Slough, Monterey Bay, CA | |||||||
| Coordinates | Lat. (o) | 36.82188 | Long. (o) | -121.744 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010070 | Metagenome / Metatranscriptome | 308 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| CGUI_GFCP3IQ02HW3CD | All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii | 504 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| CGUI_GFCP3IQ02HW3CD | CGUI_00943930 | F010070 | QMKXRGQPHLCAGLNANMYTTCIENLESILRTDKAVVYWLKNGCMHMDATGPEIVRPCPALSICSWTANLFAQPPSLVRDGVESLCPKDPKFLPTIPQEYRSLLNPAEQQNAAATGPKSF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |