x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 2044078014
2044078014: Marine sediment microbial communities from the Eel River Basin, Pacific Ocean, containing methane-oxidizing consortia - ANME2c_2rp
Overview
| Basic Information |
| IMG/M Taxon OID | 2044078014 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0045483 | Gp0051666 | Ga0010885 |
| Sample Name | Marine sediment microbial communities from the Eel River Basin, Pacific Ocean, containing methane-oxidizing consortia - ANME2c_2rp |
| Sequencing Status | Permanent Draft |
| Sequencing Center | 454 Life Sciences, Pennsylvania State University |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 21917627 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Marine Sediment Microbial Communities From The Eel River Basin, Pacific Ocean, Containing Methane-Oxidizing Consortia |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Neritic Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Eel River Basin, Pacific Ocean, Containing Methane-Oxidizing Consortia |
| Location Information |
| Location | Eel River Basin, California, USA |
| Coordinates | Lat. (o) | 40.74703 | Long. (o) | -123.869505 | Alt. (m) | N/A | Depth (m) | 500 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F054877 | Metagenome / Metatranscriptome | 139 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| ANME2c_2_ANME2c_2025433 | ANME2c_2_722560 | F054877 | MKPIKNLRVLARFSPKTTDDLEPELSNLVGTEAVFSYHRYVDADDTPYSEQWVLTAEDQRFGDYWFPECDLEVLQEMHSA |
