| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2029527005 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063141 | Gp0051980 | Ga0026423 |
| Sample Name | Atta colombica fungus garden Top |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 100904834 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Leaf Cutter Ant Microbial Communities From The University Of Wisconsin-Madison, Usa, From Fungus Growing Ant-Garden |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Garden Dump → Leaf Cutter Ant → Leaf Cutter Ant Microbial Communities From The University Of Wisconsin-Madison, Usa, From Fungus Growing Ant-Garden |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Fungus → Fungus corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gamboa, Panama | |||||||
| Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | N/A | Depth (m) | .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063112 | Metagenome | 130 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| ACOFG987_F36MELC01EQZFQ | Not Available | 546 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| ACOFG987_F36MELC01EQZFQ | ACOFGT_362340 | F063112 | AARSYDLELKTIRKDGQMTDAEMENFIERLGDKKRPLDEVRDFSLVRQAIKELEGSK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |