NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326773_049401

Scaffold Ga0326773_049401


Overview

Basic Information
Taxon OID3300034772 Open in IMG/M
Scaffold IDGa0326773_049401 Open in IMG/M
Source Dataset NameMetatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S84 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)36.0Long. (o)-78.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036059Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0326773_049401_1_414F036059GGAGMSFPGQNFTLLSQSEHIQTLINPQGDIHYEIIHQFFGPVSFLNGTITWVDMGATYKSSYTVSFGPTDISQPHTLGVQSIDLCYVLPSSHDIIHTICSFNITEGYGAFANAQGGISVVGYNAVGGTATWLVTGVFWVPA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.