NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314794_058096

Scaffold Ga0314794_058096


Overview

Basic Information
Taxon OID3300034669 Open in IMG/M
Scaffold IDGa0314794_058096 Open in IMG/M
Source Dataset NameMetatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)747
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6475Long. (o)-79.9369Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008971Metagenome / Metatranscriptome325Y

Sequences

Protein IDFamilyRBSSequence
Ga0314794_058096_136_747F008971AGGAGMPVNGVLEYLWFRDNDPWWATLLRAVTLIALVVLFAFKGMHKVPSGSRALRTRFNRVVHYRRDVYDRLGYTIHGRGEAKVVGPGLVIGIPFVHNVMVESITEQFEPLPPMIRVQPLREFASQINFKVVDLEKALVGVADYKGLLVNSCAAAVRRLVRQTALSDDDISAGVLDDESLQQRAATLGVRLLELNVASTNLTEPAQLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.