NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326748_066553

Scaffold Ga0326748_066553


Overview

Basic Information
Taxon OID3300034656 Open in IMG/M
Scaffold IDGa0326748_066553 Open in IMG/M
Source Dataset NameSeawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)514
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)13.3325Long. (o)-44.9106Alt. (m)Depth (m)2477
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004772Metagenome / Metatranscriptome424N

Sequences

Protein IDFamilyRBSSequence
Ga0326748_066553_1_288F004772AGGAGMTTNIKVAQNVSSDGAIITGFRYVDTNTSLGDEGTGSSPTPSTTRILAIHTYSTLAGELVLSGSKQITNRSAKGTAIRWRVGALDSSDQYIGDMGV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.