| Basic Information | |
|---|---|
| Taxon OID | 3300034627 Open in IMG/M |
| Scaffold ID | Ga0316609_037865 Open in IMG/M |
| Source Dataset Name | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.108B |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 874 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 45.1993 | Long. (o) | -83.3279 | Alt. (m) | Depth (m) | 185 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002525 | Metagenome / Metatranscriptome | 552 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316609_037865_731_844 | F002525 | N/A | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGRF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |