


| Basic Information | |
|---|---|
| Taxon OID | 3300034524 Open in IMG/M |
| Scaffold ID | Ga0310146_01869 Open in IMG/M |
| Source Dataset Name | Fracking water microbial communities from deep shales in Oklahoma, United States - K-7-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 14777 |
| Total Scaffold Genes | 22 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 15 (68.18%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oklahoma | |||||||
| Coordinates | Lat. (o) | 35.812 | Long. (o) | -98.262 | Alt. (m) | Depth (m) | 2943 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093744 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310146_01869_4635_4811 | F093744 | AGGAGG | MSLKIGDRVEVNYPVDDFPGHVGIVRDIKETELGTLVICYWAFLDKEIGFFEKSLDLV |
| ⦗Top⦘ |