NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314789_017422

Scaffold Ga0314789_017422


Overview

Basic Information
Taxon OID3300034480 Open in IMG/M
Scaffold IDGa0314789_017422 Open in IMG/M
Source Dataset NameMetatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R2 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)634
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6475Long. (o)-79.9369Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031903Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0314789_017422_50_634F031903N/AGGWTFSGTARFQTQSFLLRNTTLVGMTLDQAKEALSVIRYVTDPVTGALTVFNFPEDIYTNTRLAYDTDETYANYYVPGREPTGPLAAVGPDGQTYRYFAPAGGPGCNFVFTGDCGVKDIRFLGRWFGEMDFRLAKAFQLPGKARFEFSAEIFNATKALNFPNVINPSTSANAFRLTSTQSPARTAQLVWRVTW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.