NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0364934_0301499

Scaffold Ga0364934_0301499


Overview

Basic Information
Taxon OID3300034178 Open in IMG/M
Scaffold IDGa0364934_0301499 Open in IMG/M
Source Dataset NameSediment microbial communities from East River floodplain, Colorado, United States - 27_j17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)607
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment → Sediment Microbial Communities From Colorado River Basin Floodplains, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9229Long. (o)-106.9499Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001578Metagenome / Metatranscriptome669Y

Sequences

Protein IDFamilyRBSSequence
Ga0364934_0301499_13_291F001578AGGMSYNFQEVDAMGWDGDDLAGKAEEVFERQQAAADARANRGTSSVEERARSARFESLRLSRSRIMSQLASATNPAHRTMLERALKYINDEMAE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.