| Basic Information | |
|---|---|
| Taxon OID | 3300034136 Open in IMG/M |
| Scaffold ID | Ga0334933_045744 Open in IMG/M |
| Source Dataset Name | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 29HNS |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 658 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.3778 | Long. (o) | -117.6098 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073179 | Metagenome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0334933_045744_1_585 | F073179 | N/A | MVSGVALVVSMLLAWLLVPYERLGQTDAYLTSSYCVSSGLRLLAFVLLVWGLIGIYGAQSRAAGTFGLWTFVLLFLSTALAAGNVWAEVFVYPTLAQVSPGMLSGAGFETEAAYMSVGLSLSYPLFFLGLILFGAATFWAGVYPRWIALLLVISVPMTMFLDPTAGTFQESIGPAMWGLAVAAYGFYALRRTPST |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |