NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335053_0039157

Scaffold Ga0335053_0039157


Overview

Basic Information
Taxon OID3300034118 Open in IMG/M
Scaffold IDGa0335053_0039157 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3406
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (14.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002621Metagenome / Metatranscriptome542Y
F002843Metagenome / Metatranscriptome526Y
F035286Metagenome / Metatranscriptome172N

Sequences

Protein IDFamilyRBSSequence
Ga0335053_0039157_1_465F035286N/AMPFQSSDALDDQMLLDGSTGFSTGVISATRPDGIPATSMESAINMDYDDFGNLVTRLGAVSLAGNSIAANWEDIITNWESTTSNFGSNLPINATVLSGFYFDTAASERLVIAVNDLSTSTKSLYYGSPGVSYNLISGSTLNAAASYVYFAQLNDK
Ga0335053_0039157_2512_2742F002621GAGMCNMVKLPKPSRAIWLLVLPICLGCQMTRVVLVPSGDPVMLAQPTTASVYGFDKDKKLVGPSKVVLPAGWYVLPKN
Ga0335053_0039157_3167_3400F002843N/AVQVNQNNSLFVTTGVDYDSDGAVVGSEITSQYTLNPGDDLTGQPVEVVNIANALWTPAVVEAYKAANPVVEAVQPTE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.