| Basic Information | |
|---|---|
| Taxon OID | 3300034118 Open in IMG/M |
| Scaffold ID | Ga0335053_0001487 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 17025 |
| Total Scaffold Genes | 23 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 18 (78.26%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.0995 | Long. (o) | -89.4045 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024291 | Metagenome / Metatranscriptome | 206 | Y |
| F032198 | Metagenome | 180 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0335053_0001487_2784_3116 | F024291 | AGGAGG | MSTSAQGLTFTFGGSTITVTSVQVNDTQDLLDATHLGVAPNARRIFIGGFATDREVQIDYISTTILTAGQSGAMAISGPFAFSGNATVSNASLGGSVGDFVRGSATFRLA |
| Ga0335053_0001487_3928_4176 | F032198 | N/A | MTVRQLLANTDSEELSEWYAFDQRWPLPDPWQQTARLCRIVMAASGNYKRNDIPEESVFIPAAVKPNQSADQMWAELAKLKQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |