| Basic Information | |
|---|---|
| Taxon OID | 3300034116 Open in IMG/M |
| Scaffold ID | Ga0335068_0094814 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1679 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.0995 | Long. (o) | -89.4045 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034567 | Metagenome / Metatranscriptome | 174 | Y |
| F082590 | Metagenome / Metatranscriptome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0335068_0094814_101_304 | F034567 | AGAAG | MPKLFNYYDYVNHYGNRMFAIAGVNAMPARYCSILFTGSYKECMERLDPKGLEGSVEDVCQRVAFPK |
| Ga0335068_0094814_297_878 | F082590 | N/A | MTERKRFSDTLTDEQYNKLTRLDYDRKPAYPEEISSSINFNELHESIRGIVASLPIVEFPGSFFDYFLDGDQQFYLVTDKDKVFLVDTQGYDYARYVIHLKDLVVLEKEETMQMKAHPGMAEEIISMLKHMEVDGETMEHIIRSVGMEEQMLRQLIMTHTPYHQIEDLISERRQLDLPSSWTFGALNKEEVDA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |