NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335031_0123598

Scaffold Ga0335031_0123598


Overview

Basic Information
Taxon OID3300034104 Open in IMG/M
Scaffold IDGa0335031_0123598 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1808
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005697Metagenome / Metatranscriptome392Y
F014089Metagenome / Metatranscriptome266Y
F025683Metagenome / Metatranscriptome200Y

Sequences

Protein IDFamilyRBSSequence
Ga0335031_0123598_1351_1557F014089N/AMEAPGMSDLSEIIYPQSMTAKLLQNGEVIAEYKVEQCDGCAKLLKLDPFGYKIGQAGEKLAWLCGDCR
Ga0335031_0123598_537_710F025683GGAGMVLDLLDPQTLGRLVLVVILMVISAAAGYAKGFKEGKREGMARRKAMVRHMANKAVN
Ga0335031_0123598_710_1369F005697AGGCGGMGFLDNYEASRERLERWLATYPTGRIETRIVEFSAEKGYVLVEAKAFRKQADEQPAGIDYAYGYVGAYQPNMRRWFVEDTTTSAIMRVQQLVMGGAERTVREVMEQIDQTPAKIANAEKDYDYWTTKHGDVPSYKTAAEAEQSGIPSLGSSMDEIAKTLGGQLIEEAPQCSHGHRIWKQAHEGAPKNWGGYFCTERTKATQCAPNWYVLASDGKWKPQV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.