NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335031_0065534

Scaffold Ga0335031_0065534


Overview

Basic Information
Taxon OID3300034104 Open in IMG/M
Scaffold IDGa0335031_0065534 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2599
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006017Metagenome / Metatranscriptome383N
F006467Metagenome / Metatranscriptome372Y
F027501Metagenome / Metatranscriptome194N

Sequences

Protein IDFamilyRBSSequence
Ga0335031_0065534_1542_1712F006467AGGAMIKRIILDLIGGAWTVLGLLFAVVVLPEGGTQTTMATLFVLLTLGWLITGPLRWKE
Ga0335031_0065534_1714_2322F006017AGGAMKFKVKSQLDHVEKGGILDDCGPSSTAAAVAWASGYKVDPSAGDGIKAKAKATGFVEKEGVSDNGSSLGDLIKTAKEMGAKARYAKSWDDVVISAHRGAGLIIWVQQAVDYPAVEISEWHKKWQNYWLKKDKKHITQGYGHMTAAAWHAVDGWQWACPTRKGKGNEKFGVVVTEEQLKQIAASKKKITGGAAHKHVVIVEWK
Ga0335031_0065534_2332_2598F027501AGGAGMYSDIKAGIRWIIDNTGVDEALIEFFRTFVTVSISVALGLGIPLLDISGGDFRTVLSAGLASGLQVLIKFLDPKNTSFGIKEKSPEDKA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.