NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335029_0003550

Scaffold Ga0335029_0003550


Overview

Basic Information
Taxon OID3300034102 Open in IMG/M
Scaffold IDGa0335029_0003550 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12408
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)37 (90.24%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007691Metagenome / Metatranscriptome346Y
F010684Metagenome / Metatranscriptome300Y
F020910Metagenome / Metatranscriptome221Y
F022197Metagenome / Metatranscriptome215Y

Sequences

Protein IDFamilyRBSSequence
Ga0335029_0003550_2167_2397F020910GAGGMWSKYTFVCDPDECDALIQFTARDGYGFPNGSVEMRCPCGRKMAYISIEDAWEPIITDVSKVTPREVVKINTNPYN
Ga0335029_0003550_2558_2722F007691GAGMAYKVNTIDDLINEIYESNYSHLEFEENMGGEACDCHIHTTLNTIAHYAGIEVG
Ga0335029_0003550_2707_2949F022197AGGAMTLETEITENPEMYADYYSCDLAISITNIKAKNAHHAEAVMQTFIDEIGKIMTDELSWDDAQWDIEENVFLPELGEWHTK
Ga0335029_0003550_972_1160F010684GAGMTLALTARKKRRKMMNEYKVEIIFEPTGDYMTFTYEAESDNEADLCNEILNQLSIVSWKEEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.