NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335029_0002150

Scaffold Ga0335029_0002150


Overview

Basic Information
Taxon OID3300034102 Open in IMG/M
Scaffold IDGa0335029_0002150 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15723
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004232Metagenome / Metatranscriptome447Y
F016253Metagenome / Metatranscriptome248Y
F016961Metagenome / Metatranscriptome243N
F020137Metagenome / Metatranscriptome225N

Sequences

Protein IDFamilyRBSSequence
Ga0335029_0002150_14736_14885F016961AGGAMHDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0335029_0002150_14815_15315F004232GGAMSATLSLFGPNKQKPMNKTIVACDPGVNGGFAIHTKDGILLFAMPESLPDMAQLLSGFKVADSHLWIEKVPKFVSKLTPSASVATLHENYGIVQGLAYSQGYALHRVEPKIWQDPLGLGGKRSCATGPEWKRKLKSKAQELYPQLDVTLKNCDALLVLHYALGGGR
Ga0335029_0002150_15312_15467F016253GGAGGMSDKIKSFIDSGTGVYSITKKEAGEIHKAAKKVKNYAFSYWTRNRKSKEAK
Ga0335029_0002150_1830_2255F020137N/AMTAHPTNIEAAKLLREHWPAFSSWTEDQILNWICIFSSKKLFGIVNNDEGKCVGVGAVRFLNSIEESKDINNNFPDGHIAWVEIAIGTEPYAVQSLWMGMMRLCSKNVTKLGGFYKGACRLYDFNRYYKLIMNERITYGRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.