NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335027_0069826

Scaffold Ga0335027_0069826


Overview

Basic Information
Taxon OID3300034101 Open in IMG/M
Scaffold IDGa0335027_0069826 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2767
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002162Metagenome / Metatranscriptome588Y
F002357Metagenome / Metatranscriptome567Y
F020681Metagenome / Metatranscriptome222Y
F037698Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0335027_0069826_1552_1722F002162N/AMPNYDYMCDGEGSLIVLDLPMDHKIPHCQVCGAKLRRVYTAVPTIFRGTGWAGKDG
Ga0335027_0069826_1661_1951F020681N/AMFIQLCLRSFEELDGLAKMVNFRCNFCSANTEFEWLDGYPEADGFRVYMCLKCCAVGTKNLAESTDTQEPVMRCTKCGSWMFADKECHTCALIMTK
Ga0335027_0069826_1927_2046F037698AGGAGMCANHDEMTHQIDWAYQNQLRKQWLLDNPDAQYIGWMSI
Ga0335027_0069826_711_1376F002357GGAGGMAFNLEDYEDVATLNKWFISNFPSGRSDISVISHDGEKGYILVQATLWRDSKDEQPCVSNIAFGSRETYIPNMKKFYVEDTATSALGRAIILLKGSDKTATKDDMRKVESNPSFKEKLESRQNMYGKPGSKSAQIETILRDSFAADKKEPEPVAWSVGDVVAEIGAAIPNEPPACQHGHILKEGISKGGKPYRGYVCKAKECPPKWAKLTANGKWYFEGGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.