NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335012_0092401

Scaffold Ga0335012_0092401


Overview

Basic Information
Taxon OID3300034093 Open in IMG/M
Scaffold IDGa0335012_0092401 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1698
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000258Metagenome / Metatranscriptome1443Y
F001900Metagenome / Metatranscriptome620Y
F073145Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0335012_0092401_12_743F001900N/AMYSNQNGPLKDSTVAQISAYVYYEAAVISKLTTNRAFQNSFGKLMFDQINLDFGNYIDALARSKPKSLHHVYEWKKTGNKSARLFKLNKGVQVGLSFSINYQFLPSRTIVPSSNGKRRHMFIGKASVMERGEPLVIRPKNAERLVFEIDGETVFMPKGASVTVKRPGGSAARNQFTLAHSRFFSGNLINDSIKRSGFQRLFNSSITKALGVPSNIKRVQYSFSANTIRSQADEALTLAFGGAM
Ga0335012_0092401_1384_1698F073145AGGAGGMAQSVGNARNILVGASPLFLSTIDVNDADYIENAEAGVAIAAGTKTVGVPAFASGVSYANTLNAVDQTAGKFGYRNVGFTNNGLQITYNPTYDSVTVDQLLDTAK
Ga0335012_0092401_767_1270F000258GGAMLELRKYLWEELSSRDIFDADDYWSDNLNENIVPIIPVQQAPELNQFMSGKKHIVYDKIGMSYDDNWLICCEQILFTVYSTAVAEINEIRNYMTDEFRRMDESARDINRWAGLSDKFKFHSVHIADISPTAPSEELQGFFSSEIILEIKYSRDTDTNGASSTLGRFL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.