NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335020_0109626

Scaffold Ga0335020_0109626


Overview

Basic Information
Taxon OID3300034082 Open in IMG/M
Scaffold IDGa0335020_0109626 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1403
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001460Metagenome / Metatranscriptome690Y
F001781Metagenome / Metatranscriptome635Y
F007468Metagenome / Metatranscriptome350Y
F023347Metagenome / Metatranscriptome210Y

Sequences

Protein IDFamilyRBSSequence
Ga0335020_0109626_131_313F001460GGAGMLGYTEEDLNRMINAIHDVKLFYLRSPSDLMNKDPLVKDLEDAVSFMQGLWAEGYFDYTN
Ga0335020_0109626_297_491F007468GGAGGMTTQTKSSKFIEYMKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYE
Ga0335020_0109626_587_769F023347GGAGMLIWEKELENAQEAEDESGEAMDSMERTRCEGFLDALTALYQLTYQLSFAIAEKEKRNEA
Ga0335020_0109626_759_1076F001781AGGAGMKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMWNHLCEAVEAGHGFSLEYGAEQHNDDVLEWMLNREYIVDSMFEEEEEDEDATD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.