| Basic Information | |
|---|---|
| Taxon OID | 3300034072 Open in IMG/M |
| Scaffold ID | Ga0310127_112611 Open in IMG/M |
| Source Dataset Name | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1145 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 3 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 3 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oklahoma | |||||||
| Coordinates | Lat. (o) | 35.784 | Long. (o) | -98.26 | Alt. (m) | Depth (m) | 2896 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002738 | Metagenome / Metatranscriptome | 533 | Y |
| F013517 | Metagenome / Metatranscriptome | 270 | Y |
| F015987 | Metagenome / Metatranscriptome | 250 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310127_112611_149_565 | F002738 | N/A | MAIDTYGLSTEQYTEFFQKNLRLAAKLYLDTCNIMSSEGVGNADFKTVLDLYQEAMYAANDDCRRYQKSNNPEVLKENDVYGIVPSHQEIIEAVETLMKYTEALDAKLQALTDYVSNLVTVTTAGLEGIATTLDDKVD |
| Ga0310127_112611_639_752 | F013517 | N/A | MFESLFAAVLPVLKDILWAAAGALLTYALNKFQSQFN |
| Ga0310127_112611_756_1145 | F015987 | N/A | MSQITQAKLKDLSVIKLYEHYAALEKSLPLLTPESQELAKAELESCADLRSEKIDRIYYAMAAHEDALERIKKEGDLIMQAKRHHESQLRSLKGLLNYLRRVLPQDTNKITGRNYQFTLVKKKELTVEVS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |