NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310127_055757

Scaffold Ga0310127_055757


Overview

Basic Information
Taxon OID3300034072 Open in IMG/M
Scaffold IDGa0310127_055757 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1938
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.784Long. (o)-98.26Alt. (m)Depth (m)2896
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007855Metagenome / Metatranscriptome343N
F062571Metagenome130N

Sequences

Protein IDFamilyRBSSequence
Ga0310127_055757_1485_1916F007855N/AMPAKAVLKRYKAIVSEWNALPALGYKRKFKAGGKWWIPTVFTDELTAGQLIELMDINTTDEKQLLQNLHRIMASLSREGGLFGFFPKKYDGAAHAERAELMKKHAKVGDVWGVVSFFLLSSESYLKVLSDYSKHLMKTAEGLT
Ga0310127_055757_2_628F062571N/AMAVTVLSGSPLVATPVYNKMLFKVSGSQIAQPNYRYVCDVKNPAGTTLARLKCDKLPTTNFGFFDVAKVVETLIAPTKPSLTQTGFVDHAGYYSGYRLDFMEEYGNTPVVYTGTVTTVSGNVSFAGNLEQLEFQDWTISPYFRIGQSFPSTRALTSQRAFTVYHGGKAWLAINATKYQAVAPNDTWLVSGQVTYKGVDYDIAVNPSLSG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.