NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310127_017913

Scaffold Ga0310127_017913


Overview

Basic Information
Taxon OID3300034072 Open in IMG/M
Scaffold IDGa0310127_017913 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4492
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.784Long. (o)-98.26Alt. (m)Depth (m)2896
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003267Metagenome / Metatranscriptome496N
F006503Metagenome / Metatranscriptome371N
F025272Metagenome / Metatranscriptome202N

Sequences

Protein IDFamilyRBSSequence
Ga0310127_017913_198_449F025272GAGMDILVYPILISALATLAVVEFRVLPSWFYALPFAKRKPFSCMTCFGFWMGVALTLPTCQWFLAPILGLASSATAIIIREWTFK
Ga0310127_017913_3946_4491F003267N/AMKVVHYYHIYCGGNWQLILNQHMMAVCNYGLINVLDEIRVGIVGPPEQRKAVKEVLENSMVAEKVKVVVTRTNAWEQATLTEMYRASQDEEAVYLYAHTKGASNPALTTQLWGRSMLFFNVVAWERSLQMLEGVDAVGCHWITKEQFPHMADQNNPEGYPYFGGNFWWAKSSHIKELGEPKR
Ga0310127_017913_434_715F006503N/AMDLQMTAEQFIVAQKHRKYWDQYVASLTMRLPPDAVGELQAILTAHGRPPTNWWCADCVKSALQYIYLQADLFAESNQNTITHPLNAPTDTER

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.