| Basic Information | |
|---|---|
| Taxon OID | 3300034061 Open in IMG/M |
| Scaffold ID | Ga0334987_0046551 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3636 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (10.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.0995 | Long. (o) | -89.4045 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002778 | Metagenome / Metatranscriptome | 530 | N |
| F023348 | Metagenome / Metatranscriptome | 210 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0334987_0046551_3037_3447 | F002778 | N/A | MKEWNSKMLEIQSFCEEVNTWISVAPSAEMLDECDQYLRQLSAYYSRYTVISGMNESIFAQMMMSCIRDMPEEEYKRIKHSSTLTDYYVKGKYPKATAIFEQCRAVQKLLLVTSDNYRTLLSSFRQERILVGHMAT |
| Ga0334987_0046551_3_503 | F023348 | N/A | MKKNFNNQNFEWLFDDITSTMPKIIFVGIILTYAITAALNVYFLPLPLLLSIPASLMLQFGRFAIVFIDFLNPSTKRSKYPPKVAAIATVVALLELFFSIQGQATGAEFYAMFFFIGTIICFGYALEIQFIEKGIEAYGIGMKEPRKRSVPKKEKEPVQMNTTVRSV |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |