NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335002_0020584

Scaffold Ga0335002_0020584


Overview

Basic Information
Taxon OID3300034020 Open in IMG/M
Scaffold IDGa0335002_0020584 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4933
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029017Metagenome / Metatranscriptome189Y
F031754Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0335002_0020584_2920_3357F031754N/AMNEKGGPVIMVVLLLGLFWLCSEPAKEPTQCDLLDSTPLIEEVAKVEFVATPKEPDPMPSPSDKPHEAVKREILVFLAPKDQKCEPCDRWKRCEMQRFIDAKWDVAIFDEPHNYGRTPTFEVKSGDKKATLTGYTTLEQAAEAVR
Ga0335002_0020584_4323_4565F029017GGAMDELGLVTWYIVQLVLWAGPFGVAAFLAVIAGAAFYAGYLMRPKRTDKPMGNVKMDHIKYDILPDGTLSPGDNRGLEDPE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.